PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10022879m
Common NameCARUB_v10022879mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family EIL
Protein Properties Length: 588aa    MW: 66841 Da    PI: 5.9262
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10022879mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN35161.7e-157494331354
                      XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
             EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraW 94 
                      +el+krmw+d+m+lkrlke++ +   +ke  ++ +k+++s+eqarrkkmsraQDgiLkYMlk+mevc+aqGfvYgiipekgkpv+gasd+Lr+W
  Carubv10022879m  49 DELEKRMWRDKMRLKRLKEQQSKC--SKEG-VDGSKQRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPEKGKPVTGASDNLREW 139
                      79*******************984..4787.9999*********************************************************** PP

                      XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--T CS
             EIN3  95 WkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglsk 188
                      Wk+kv+fdrngpaai+kyqa+n+i++g++++++    ++h+l+elqDTtlgSLLsalmqhcdppqrrfplekgv+pPWWP+Gke+ww++lgl++
  Carubv10022879m 140 WKDKVRFDRNGPAAIAKYQAENNISGGSNDCNSLVGPTPHTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGVSPPWWPNGKEDWWPQLGLPN 233
                      ********************************99************************************************************ PP

                      T--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX..XX...XXXXXXXXXXXX CS
             EIN3 189 dqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsah..ss...slrkqspkvtls 277
                      +qg+ppykkphdlkkawkv+vLtavikhmsp+i++ir+l+rqsk+lqdkm+akes+++l+++nqee  +++++++  ++    l+ +s ++ ++
  Carubv10022879m 234 EQGPPPYKKPHDLKKAWKVGVLTAVIKHMSPDIAKIRKLVRQSKCLQDKMTAKESATWLAIINQEEVVARELYPEscPPlssALSLGSGSLLIN 327
                      ***************************************************************************65225446666******** PP

                      XXXXXXXX.XXXXXX.XXXXXXXXXX............................XXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXXX CS
             EIN3 278 ceqkedve.gkkeskikhvqavktta............................gfpvvrkrkkkpsesakvsskevsrtcqssqfrgseteli 342
                      + +++dve  +ke+   +v+++k +                             ++++ rkrk +++ + +++++ + +tc++ q+++s+++++
  Carubv10022879m 328 DCSEYDVEgFEKEQPSFDVEERKPEIvmmnpptnfgiakmqhfpikeevpatmgNLEFSRKRKPNNDMNVMIMERPAGYTCENGQCPHSKMNMG 421
                      ********9777777789999999779************************************9999999999999****************** PP

                      XXXXXXXXXXXX CS
             EIN3 343 fadknsisqney 354
                      f+d++s++++++
  Carubv10022879m 422 FQDRSSRDNHQM 433
                      **********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048737.1E-13149299No hitNo description
Gene3DG3DSA:1.10.3180.107.0E-75174309IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167681.31E-61178302IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0042742Biological Processdefense response to bacterium
GO:0071281Biological Processcellular response to iron ion
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 588 aa     Download sequence    Send to blast
MMMFNEMGMY GNMDFFPSST SIDVCPLPQA EQEPVVEDVD YTDDEMDVDE LEKRMWRDKM  60
RLKRLKEQQS KCSKEGVDGS KQRQSQEQAR RKKMSRAQDG ILKYMLKMME VCKAQGFVYG  120
IIPEKGKPVT GASDNLREWW KDKVRFDRNG PAAIAKYQAE NNISGGSNDC NSLVGPTPHT  180
LQELQDTTLG SLLSALMQHC DPPQRRFPLE KGVSPPWWPN GKEDWWPQLG LPNEQGPPPY  240
KKPHDLKKAW KVGVLTAVIK HMSPDIAKIR KLVRQSKCLQ DKMTAKESAT WLAIINQEEV  300
VARELYPESC PPLSSALSLG SGSLLINDCS EYDVEGFEKE QPSFDVEERK PEIVMMNPPT  360
NFGIAKMQHF PIKEEVPATM GNLEFSRKRK PNNDMNVMIM ERPAGYTCEN GQCPHSKMNM  420
GFQDRSSRDN HQMVCPYRNN HLAYGATKFH MGEMKPVALQ QPVQAIDLSG FGVPENGQKM  480
ITELMAMYDR NVQSNQTPPP PLIENQTMTL DAKAAQNQNQ LSFNNSNQMF MQQGTNSGIN  540
NRFQMVFDST PFDMAAFDYR DDWQTGAMEG IGKQQQQQQQ QDVSIWF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A2e-861773092134Protein ETHYLENE INSENSITIVE 3
4zds_B2e-861773092134Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0056230.0AC005623.3 Arabidopsis thaliana chromosome 2 clone T20P8 map B68, complete sequence.
GenBankAF0042130.0AF004213.1 Arabidopsis thaliana ethylene-insensitive3-like1 (EIL1) mRNA, complete cds.
GenBankAY0651910.0AY065191.1 Arabidopsis thaliana ethylene-insensitive3-like1 (EIL1) (At2g27050; T20P8.10) mRNA, complete cds.
GenBankBT0033440.0BT003344.1 Arabidopsis thaliana ethylene-insensitive3-like1 (EIL1) (At2g27050) mRNA, complete cds.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006293460.10.0hypothetical protein CARUB_v10022879mg
SwissprotQ9SLH00.0EIL1_ARATH; ETHYLENE INSENSITIVE 3-like 1 protein
TrEMBLR0HQU90.0R0HQU9_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.4__646__AT2G27050.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21352879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27050.10.0ETHYLENE-INSENSITIVE3-like 1